General Information

  • ID:  hor002358
  • Uniprot ID:  P15513??53-60)
  • Protein name:  Myomodulin-B
  • Gene name:  MYOMOD1
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  animal
  • Expression:  Expressed in all ganglia of the CNS, but only in a subset of neurons including L10 in the abdominal ganglion and B16 in the buccal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GSYRMMRL
  • Length:  8(53-60)
  • Propeptide:  MQVYMLLPLAVFASLTYQGACEETAAAQTSSDASTSSASSEHAENELSRAKRGSYRMMRLGRGLHMLRLGKRGGPVEPESEENLETLLNLLQGYYSDVPEYPSEFDDTDLAYPYEEYDAPAHPRYRRSTPPTDGVVAPDVLQKGSSEFEDFGDSQLDESDEGYYGYDPENYLYGDFEDYLEPEEGGLGEEKRSLSMLRLGKRGLSMLRLGKREGEEGDEMDKKQDESLNDDFENDDIKRTLSMLRLGKRPMSMLR
  • Signal peptide:  MQVYMLLPLAVFASLTYQ
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potentiates ARC muscle contraction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P15513-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002358_AF2.pdbhor002358_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 113827 Formula: C42H72N14O11S2
Absent amino acids: ACDEFHIKNPQTVW Common amino acids: MR
pI: 11.15 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 1
Hydrophobicity: -48.75 Boman Index: -2282
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: -2541.25 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  1788132
  • Title:  Structure, Bioactivity, and Cellular Localization of Myomodulin B: A Novel Aplysia Peptide